PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02091.1.g00010.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 770aa    MW: 81947.1 Da    PI: 5.4632
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02091.1.g00010.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.9e-2199154156
                                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     r++ +++ ++q++eLe+lF+++++p+ ++r eL+++lgL+ rqVk+WFqNrR+++k
  Zpz_sc02091.1.g00010.1.sm.mkhc  99 RKRYHRHMPQQIQELEALFKECPHPDDKQRGELSTRLGLDPRQVKFWFQNRRTQMK 154
                                     67788999*********************************************999 PP

2START216.5e-08315395169
                                     HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCH.HHHHHHHHCC CS
                           START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmv.lallveelld 67 
                                     ela +a++elvk+a+ +ep+W +  ++ +++ +l  +e +++           + +ea+r+sg+v+ + +a lve+l+d
  Zpz_sc02091.1.g00010.1.sm.mkhc 315 ELAISAMDELVKMAQMDEPLWLTTISGAPNKATLNFVEYARSfvpclgmkpmgFVSEASRESGLVIINdSAALVETLMD 393
                                     57889********************88888888888877777788888****************98652679******* PP

                                     CG CS
                           START  68 dk 69 
                                     ++
  Zpz_sc02091.1.g00010.1.sm.mkhc 394 QM 395
                                     98 PP

3START132.45.1e-4239451393206
                                     EEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEEE CS
                           START  93 lmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskvt 165
                                     +m+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d     p+     +++ v++++lpSg++ie+++ng++kvt
  Zpz_sc02091.1.g00010.1.sm.mkhc 394 QMKAELQVLSPLVPiREVTFLRFSKQLAEGAWAVVDVSIDGLIRGPNsattsTAGNVKCRRLPSGCVIEDTPNGYCKVT 472
                                     799*************************************87666665666799************************* PP

                                     EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                     wveh++++++++h+l+r+l++sgla+ga++w+atlqrqce+
  Zpz_sc02091.1.g00010.1.sm.mkhc 473 WVEHTEYDEASVHELYRPLLRSGLAFGARRWLATLQRQCES 513
                                     ***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-2082156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2284156IPR009057Homeodomain-like
PROSITE profilePS5007117.36296156IPR001356Homeobox domain
SMARTSM003891.5E-1897160IPR001356Homeobox domain
CDDcd000862.52E-1898156No hitNo description
PfamPF000461.6E-1899154IPR001356Homeobox domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084832.616306516IPR002913START domain
SuperFamilySSF559611.54E-24308514No hitNo description
CDDcd088752.20E-91310512No hitNo description
SMARTSM002349.9E-26315513IPR002913START domain
PfamPF018523.2E-36394513IPR002913START domain
SuperFamilySSF559614.07E-20542761No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MNFGSFFNGG AGGGSGSGSG GMQFPYSAGF SSSPALSLGR DNAGGVLSGG AGVGADGGAM  60
VRDADAENDS RSGSDHLDAM SGGGEEEDDA KPGSSGKRRK RYHRHMPQQI QELEALFKEC  120
PHPDDKQRGE LSTRLGLDPR QVKFWFQNRR TQMKTQLDRH ENSLLKQESD KLRSENVTIR  180
EAMRNPTCGS CGSSAVLGEV SLEEQHLLIE NARLKDEINR VYSLAAKFLN KPLPSLSRGH  240
QLPPHLSLPM PSSSLELAIG ALGGMGSMPP ATMPGSMAEF AGGVSNPLGT VITPVRATGA  300
APPPMVGIDR SMLLELAISA MDELVKMAQM DEPLWLTTIS GAPNKATLNF VEYARSFVPC  360
LGMKPMGFVS EASRESGLVI INDSAALVET LMDQMKAELQ VLSPLVPIRE VTFLRFSKQL  420
AEGAWAVVDV SIDGLIRGPN SATTSTAGNV KCRRLPSGCV IEDTPNGYCK VTWVEHTEYD  480
EASVHELYRP LLRSGLAFGA RRWLATLQRQ CESLAILMSP GTVSANDASV ITQEGKRSML  540
KLARRMTDNF CAGVSASSAR EWSKLDGAAG SIGEEDVRVM VRKSVNEPGE PPGVVLSAAT  600
SVWVPVAPER LFNFLRNEQL RADWDILSNG GPMQEMASVA KGQGRGNSVS LLRAGAMSSN  660
QSSMLILQET CTDASGSMVV YAPVDIPAMQ LVMNGGDSTY VALLPSGFAI LPDGPSTEHN  720
TGGGSLLTVA FQILVNSQPT AKLTVESVET VNNLISCTVN KITNALPCDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457484.10.0hypothetical protein SORBIDRAFT_03g008090
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLC5XEA60.0C5XEA6_SORBI; Putative uncharacterized protein Sb03g008090
STRINGSb03g008090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1